The domain within your query sequence starts at position 47 and ends at position 306; the E-value for the CENP-K domain shown below is 1.5e-124.
TITDVEAVIDTEEELIKECEEMWKDMEDCQNKLSLIGTETLTNADAQLSLLIMQMKCLTA ELGQWKKRKPEIIPLNEDVLLTLGKEEFQKLRCDLEMVLSTIQSKNEKLKEDLEREQQWL DEQQQILDTLNVLNSDVENQVVTLTESRIFNELTTKIRGIKEFKEKLLLTLGAFLDNHFP LPEASTPKKRKNIQDSNAQLITLNEILEMLINRMFDVPHDPYVKIRDSFWPPYIELLLRY GIALRHPEDPSQIRLEAFHQ
CENP-K |
---|
PFAM accession number: | PF11802 |
---|---|
Interpro abstract (IPR020993): | Cenp-K is one of seven new Cenp-A-nucleosome distal (CAD) centromere components (the others being Cenp-L, Cenp-O, Cenp-P, Cenp-Q, Cenp-R and Cenp-S) that are identified as assembling on the Cenp-A nucleosome associated complex, NAC [ (PUBMED:16622419) ]. The Cenp-A NAC is essential, as disruption of the complex causes errors of chromosome alignment and segregation that preclude cell survival despite continued centromere-derived mitotic checkpoint signalling. Cenp-K is centromere-associated through its interaction with one or more components of the Cenp-A NAC. It may be involved in incorporation of newly synthesized Cenp-A into centromeres via its interaction with the Cenp-A-NAC complex [ (PUBMED:18045986) ]. The homologue in Schizosaccharomyces pombe is known as inner kinetochore subunit sim4 [ (PUBMED:12719471) (PUBMED:18007590) ]. |
GO process: | kinetochore assembly (GO:0051382) |
GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-K