The domain within your query sequence starts at position 177 and ends at position 327; the E-value for the CENP-L domain shown below is 3.3e-38.

EDFTCLPLFLANGAESNTSLIRDWFQKTFDCCFSPLAISAFNLSWMAAMWTACKMDRYMA
TTEFLWSVPCSPQSLDISYAIHPEDAKALWESVHKTPGEVTQEEVDLFMNCLYSHFHRHF
KIHLAATRLVRVSTSVASAHTDGKIKVSLNR

CENP-L

CENP-L
PFAM accession number:PF13092
Interpro abstract (IPR025204):

The centromere, which is the basic element of chromosome inheritance, is epigenetically determined in mammals. All active centromeres are characterised by the presence of long arrays of nucleosomes in which CENP-A replaces histone H3. CENP-A assembles an array of nucleosomes and it is this that seems to be the prime candidate for specifying centromere identity. CENP-A nucleosomes directly recruit a proximal CENP-A nucleosome associated complex (NAC) comprised of CENP-M, CENP-N and CENP-T, CENP-U(50), CENP-C and CENP-H. Assembly of the CENP-A NAC at centromeres is dependent on CENP-M, CENP-N and CENP-T. Additionally, there are seven other subunits which make up the CENP-A-nucleosome distal (CAD) centromere, CENP-K, CENP-L, CENP-O, CENP-P, CENP-Q, CENP-R and CENP-S, also assembling on the CENP-A NAC [(PUBMED:16622419)].

CENP-L is one of the components that assembles onto the CENP-A-nucleosome distal (CAD) centromere. Fta1 is the equivalent component of the fission yeast Sim4 complex [(PUBMED:16079914)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-L