The domain within your query sequence starts at position 3 and ends at position 337; the E-value for the CENP-N domain shown below is 3.4e-81.

ENVAEFLRRTILKIPLSEMKSILEAWDFLSEDQLQTINLKQRKDYLAQEVILLCEDKRAS
LDDVVLLDIVYTQFHRHQKLWNVFQMSKEPGEDVDLFDMEQFQSSFKRILQRALKNVTVS
FRVYEKDSVWIRVAWGTQYSQPNQYKPTFVVYYPQTPYAFISSCHLKNTVPLLHQALKVA
SKHHQIVHLDLRSRHLDSLKAIVFREYNQTCENYSSTTSLQEASLSMCLDSKITHENTEE
KVRVHRVTQETFGTYPQPQLEFAQYKLETKFKSNIGGGLLADRKEPFRCLVKFSSPHLLE
ALKSLAPAGIADAPLSPLLTCIPSKKMNYFKIRDK

CENP-N

CENP-N
PFAM accession number:PF05238
Interpro abstract (IPR007902):

This family includes Chl4 from budding yeasts, mis15 from fission yeasts and centromere protein N (CENP-N) from animals.

In Saccharomyces cerevisiae, Chl4 is an outer kinetochore structural component required for chromosome stability [(PUBMED:12589047)]. Chl4 is a component of the Ctf19 kinetochore complex that interacts with Ctf19p, Ctf3p, Iml3p and Mif2p [(PUBMED:12589047)]. It is required for establishing bipolar spindle-microtubule attachments and proper chromosome segregation [(PUBMED:9339342)].

In Schizosaccharomyces pombe, mis15 is a subunit of the Sim4 complex, which is required for loading the DASH complex onto the kinetochore via interaction with dad1 [(PUBMED:21445296)]. It is required for correct chromosome segregation where it has a role in the formation and/or maintenance of specialised chromatin at the centromere [(PUBMED:16855021)].

In humans, centromere protein N (CENP-N) is a component of the CENPA-NAC (nucleosome-associated) complex, which plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation [(PUBMED:16716197)]. CENP-N localises exclusively in the kinetochore domain of centromeres [(PUBMED:16622419)]. It is required for chromosome congression and efficiently align the chromosomes on a metaphase plate [(PUBMED:19543270)].

GO process:kinetochore assembly (GO:0051382), chromosome segregation (GO:0007059)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-N