The domain within your query sequence starts at position 1 and ends at position 74; the E-value for the CENP-O domain shown below is 2.1e-17.

MCISTAFEGNLLDSYFVDLVIEKPLRIHHHSVPVFIPLEKIAAAHLQTDVQRFLFRLWEY
LNAYAGRKYQADQL

CENP-O

CENP-O
PFAM accession number:PF09496
Interpro abstract (IPR018464):

This entry represents centromere protein O (CENP-O) and its homologues in yeasts, Mcm21 and Mal2.

In humans, centromere protein O (CENP-O) is a component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation [(PUBMED:16622419)]. CENP-O mediates the attachment of the centromere to the mitotic spindle by forming essential interactions between the microtubule-associated outer kinetochore proteins and the centromere-associated inner kinetochore proteins. CENP-O modulates the kinetochore-bound levels of NDC80 complex [(PUBMED:18007590)]. It may be involved in incorporation of newly synthesized CENP-A into centromeres via its interaction with the CENPA-NAC complex [(PUBMED:16622420)].

In Saccharomyces cerevisiae, Mcm21 is a component of the kinetochore sub-complex COMA (Ctf19p, Okp1p, Mcm21p, Ame1p), which links kinetochore subunits with subunits bound to microtubules during kinetochore assembly [(PUBMED:14633972), (PUBMED:22561346)].

In Schizosaccharomyces pombe, Mal2 is a component of the Sim4 complex, which is required for loading the DASH complex onto the kinetochore via interaction with Dad1 [(PUBMED:12242294)]. It plays a role in the maintenance of core chromatin structure and kinetochore function [(PUBMED:16079914)].

GO process:centromere complex assembly (GO:0034508)
GO component:kinetochore (GO:0000776)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-O