The domain within your query sequence starts at position 102 and ends at position 278; the E-value for the CENP-P domain shown below is 3.9e-89.

QKHRLSGNCNMVTFQLEFEVLEMETKEKKSSIITDLSIIMEPTEYSELSEFASRAEEKRD
LLMFFRSLHFFVEWCEYRENTFKHFKEKYPDTVYLLEGTCSHCMEIRSTRQPGFELVIVW
KIQIDEEGMVFPKLDLLTKVPERALGLDKNRVIETAPLSFRSLLGVLGIEAALDSLI

CENP-P

• PFAM accession number: PF13096
• Interpro abstract (IPR027801):

  CENP-P is a component of the CENPA-CAD (nucleosome distal) complex. The centromere, which is the basic element of chromosome inheritance, is epigenetically determined in mammals. CENP-A, the centromere-specific histone H3 variant, assembles an array of nucleosomes and it is this that seems to be the prime candidate for specifying centromere identity. CENP-A nucleosomes directly recruit a proximal CENP-A nucleosome associated complex (NAC) comprised of CENP-M, CENP-N and CENP-T, CENP-U(50), CENP-C and CENP-H. Assembly of the CENP-A NAC at centromeres is dependent on CENP-M, CENP-N and CENP-T. Additionally, there are seven other subunits which make up the CENP-A-nucleosome distal (CAD) centromere, CENP-K, CENP-L, CENP-O, CENP-P, CENP-Q, CENP-R and CENP-S, also assembling on the CENP-A NAC [ (PUBMED:16622419) ]. Fta7 is the equivalent component of the fission yeast Sim4 complex [ (PUBMED:16079914) ].

• GO process: CENP-A containing nucleosome assembly (GO:0034080)
• GO component: chromosome, centromeric region (GO:0000775)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-P