The domain within your query sequence starts at position 118 and ends at position 268; the E-value for the CENP-Q domain shown below is 7.4e-20.

RLLQQCATLKVPPRKLNYLKDVSKMLKMEKAQERANEESLASLQEEIDKIVETTESMTES
IQSLKNKIQILTSEVEEEEQEVKQVFHIDSNKVLALPELSQKSLKAPILQEEILALIPNQ
NALLKDLDVLHDSAPVKNVSAFIEEAYKKLD

CENP-Q

CENP-Q
PFAM accession number:PF13094
Interpro abstract (IPR025212):

This entry includes CENP-Q and Fta7 proteins. CENP-Q is one of the components that assembles onto the CENP-A-nucleosome distal (CAD) centromere. Fta7 is the equivalent component of the fission yeast Sim4 complex [(PUBMED:16079914)].

The centromere, which is the basic element of chromosome inheritance, is epigenetically determined in mammals. CENP-A, the centromere-specific histone H3 variant, assembles an array of nucleosomes and it is this that seems to be the prime candidate for specifying centromere identity. CENPA nucleosomes directly recruit a proximal CENPA-nucleosome-associated complex (NAC) comprised of CENP-M, CENP-N and CENP-T, CENP-U(50), CENP-C and CENP-H. Assembly of the CENPA NAC at centromeres is dependent on CENP-M, CENP-N and CENP-T. Additionally, there are seven other subunits which make up the CENPA-nucleosome distal (CAD) centromere, CENP-K, CENP-L, CENP-O, CENP-P, CENP-Q, CENP-R and CENP-S, also assembling on the CENP-A NAC [(PUBMED:16622419)]. Fta7 is the equivalent component of the fission yeast Sim4 complex [(PUBMED:16079914)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-Q