The domain within your query sequence starts at position 424 and ends at position 479; the E-value for the CENP-S domain shown below is 3e-12.

CTKMPVEKTALEIVEKCLDKYFQHLCNDLEVFASHAGRKIVKPEDLLLLMRRQGLV

CENP-S

CENP-S
PFAM accession number:PF15630
Interpro abstract (IPR029003):

This entry includes animal centromere protein S (CENP-S) and its yeast homologue, Mhf1. CENP-S/Mhf1 is a component of the FANCM-MHF complex, an essential DNA-remodeling complex that protects replication forks in response to DNA damage [(PUBMED:20347428), (PUBMED:24026537), (PUBMED:24256282)]. FANCM-MHF promotes gene conversion at blocked replication forks, probably by reversal of the stalled fork [(PUBMED:20347428), (PUBMED:24026537)].

CENP-S is a dual function protein. It aids DNA repair/recombination and localises to centromeres to promote chromosome segregation [(PUBMED:24256282)]. It is a kinetochore component that forms complexes with CENP-X to form a stable CENP-T-W-S-X heterotetramer [(PUBMED:20702077), (PUBMED:22304917)].

GO component:FANCM-MHF complex (GO:0071821)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-S