The domain within your query sequence starts at position 1 and ends at position 86; the E-value for the CENP-W domain shown below is 2.4e-52.
MAPSTTVTRRVKRKAPRAFLKRTLKQKKPHLGLGRCCDLLIHLNCLLFIQRLAEESRTNA CESKSRVIKKDHVLAAGKVILKKSRG
CENP-W |
 |
|---|
| PFAM accession number: | PF15510 |
|---|---|
| Interpro abstract (IPR028847): | Centromere protein W (CENP-W) is a component of the CENPA-NAC (nucleosome-associated) complex, which plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation [ (PUBMED:19070575) ]. CENP-W gene is up-regulated in various types of cancers and was first identified as a putative oncogene, CUG2 [ (PUBMED:17610844) ]. It can be regulated by CSN5, a component of the CSN complex involved in protein degradation via the ubiquitin-proteasome pathway [ (PUBMED:23926101) ]. The DNA-binding regions in CENP-T or CENP-W is essential for inducing positive supercoils into DNA and for the kinetochore targeting of the CENP-T-W-S-X complex [ (PUBMED:24234442) ]. |
| GO process: | mitotic cell cycle (GO:0000278), kinetochore assembly (GO:0051382) |
| GO function: | DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP-W