The domain within your query sequence starts at position 115 and ends at position 261; the E-value for the CENP_C_N domain shown below is 2.6e-46.
HHGASDELDLCVGSPVVLLDANVNTLQKAASPAGQKRVASVSRSPVDRQASNKNISFKTR KRLNFEDKVTLSTAETENSVLQVEDNLSKGQEGTSSEITQKRDDLSSDVQSRSKKNFSEL FLETVKRKSKSSSVVRHTAAVPFSPPP
CENP_C_N |
---|
PFAM accession number: | PF15622 |
---|---|
Interpro abstract (IPR028052): | CENP-C is a vertebrate family that forms a core component of the centromeric chromatin. On depletion of CENP-C, proper formation of both centromeres and kinetochores is prevented. In kinetochores, the KMN (KNL1/Mis12/Ndc80) network regulates kinetochore microtubule binding [ (PUBMED:17129783) ]. The N-terminal of CENP-C is necessary for recruitment of some but not all components of the Mis12 complex to centromeres [ (PUBMED:20702077) (PUBMED:21353555) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CENP_C_N