The domain within your query sequence starts at position 449 and ends at position 708; the E-value for the CEP170_C domain shown below is 7.4e-102.
PSALKTTRMQSTGSAMPASSSFKHRIKEQEDYIRDWTAHREEIARISQDLALIAREINDV AGEIDSVTSSGTAPSTTVSTAATTPGSAIDTREEVGDLHGEMHKLVDRVFDESLNFRKIP PLVHSKTPEGNNGRSVDSRPQPAEHPDHLTITRRRTWSRDEVMGDNLLLSSVFQFSRKIR QSIDKTAGKIRILFKDKDRNWDDIENKLRAESEVPIVKTSSMEISSILQELKRVEKQLQV INAMIDPDGTLEALNNMGFP
CEP170_C |
---|
PFAM accession number: | PF15308 |
---|---|
Interpro abstract (IPR029300): | This entry represents the C terminus of centrosomal protein of 170kDa (CEP170) [ (PUBMED:15616186) ]. Centrosomal protein of 170kDa (Cep170) plays a role in microtubule organisation [ (PUBMED:15616186) ]. Human Cep170 is constantly expressed throughout the cell cycle, but phosphorylated during mitosis. Cep170 is a substrate of Polo-like kinase 1 (Plk1) [ (PUBMED:15616186) ]. It is associated with the mature mother centriole. Cep170 is also required for Kif2b-induced microtubule depolymerisation [ (PUBMED:23087211) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CEP170_C