The domain within your query sequence starts at position 795 and ends at position 1499; the E-value for the CEP170_C domain shown below is 1.8e-261.

IQNESKRRKAEEIPKCQASKGDKKESSKSLVRQGSFTIDKPSSNIPIELIPHINKQNSSV
PTALALTSASRLRERSDSLDTDSSMDTTLILKDTEAVMAFLEAKLREDNNKTDEGPDTPS
YNRDNSISPESDVDTASTISLVTGETERKSTQKRKSFTSLYKDRCSTSSPSKDVTKSGSR
EKIEKKAKSRSADIGARADGRKFVQSSGRIRQPSIDLTDDDQTSSVPHSAISDIMSSDQE
TYSCKSHGRTPLTSADEHNIHSKLEGGKATKSKTSPVASGSTSKSTTLPRPRPTRTSLLR
RARLGEASDSELADADKASVASEVSTTSSTSKPPTGRRTISRIDLLAQPRRTRLGSLSAR
SDSEATISRSSASARTAEAVIRSGARLVPSDKLSPRTRANSISRLSDSKVKSMSSTHGSP
SVNSRWRRFPTDYASTSEDEFGSNRNSPKHTRLRTSPALKTTRMQSTGSAMPASSSFKHR
IKEQEDYIRDWTAHREEIARISQDLALIAREINDVAGEIDSVTSSGTAPSTTVSTAATTP
GSAIDTREELVDRVFDESLNFRKIPPLVHSKTPEGNNGRSVDSRPQPAEHPDHLTITRRR
TWSRDEVMGDNLLLSSVFQFSRKIRQSIDKTAGKIRILFKDKDRNWDDIENKLRAESEVP
IVKTSSMEISSILQELKRVEKQLQVINAMIDPDGTLEALNNMGFP

CEP170_C

CEP170_C
PFAM accession number:PF15308
Interpro abstract (IPR029300):

This entry represents the C terminus of centrosomal protein of 170 kDa (CEP170) [(PUBMED:15616186)].

Centrosomal protein of 170 kDa (Cep170) plays a role in microtubule organisation [(PUBMED:15616186)]. Human Cep170 is constantly expressed throughout the cell cycle, but phosphorylated during mitosis. Cep170 is a substrate of Polo-like kinase 1 (Plk1) [(PUBMED:15616186)]. It is associated with the mature mother centriole. Cep170 is also required for Kif2b-induced microtubule depolymerisation [(PUBMED:23087211)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CEP170_C