The domain within your query sequence starts at position 5 and ends at position 136; the E-value for the CEP44 domain shown below is 1.7e-53.
DLKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSIE
LIAKNDVRFTDTVYKLLRDQFDYKPILTKKQFIQSGFAEWKIEIVCDILNCVMKKHKELI
GLDKNSSCQRKK
CEP44 |
 |
---|
PFAM accession number: | PF15007 |
---|
Interpro abstract (IPR029157): |
Several proteins have been identified that localise to centrosomes and spindle poles, and they have been named accordingly to their molecular weight [(PUBMED:21399614)]. This entry represents a coiled coil domain found in centrosomal protein of 44 kDa (CEP44).
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CEP44