The domain within your query sequence starts at position 5 and ends at position 63; the E-value for the CEP44 domain shown below is 3.2e-19.

DLKRSLRKLEQVLRSLNYPNEVDYVGLIKGDTAASLPIISYSLTSYSPYVAELLMESSI

CEP44

CEP44
PFAM accession number:PF15007
Interpro abstract (IPR029157):

Several proteins have been identified that localise to centrosomes and spindle poles, and they have been named accordingly to their molecular weight [ (PUBMED:21399614) ]. This entry represents a coiled coil domain found in centrosomal protein of 44kDa (CEP44).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CEP44