The domain within your query sequence starts at position 76 and ends at position 338; the E-value for the CEP63 domain shown below is 8.1e-112.

LTSCEAELQELMKQIDIMVAHKKSEWEGQTHALETCLDIRDRELKALRSQLDMKHKEVGI
LHQQIEEHEKTKQEMAMEYKEELLKLQEELSRLKRSYEKLQKKQLREFRGNTKSFREDRS
EIERLTGKIEEFRQKSLDWEKQRLIYQQQVSSLEAQRKALAEQSEIIQAQLANRKQKLES
VELSSQSEIQHLNSKLERAKDTICANELEIERLNIRVNDLMGTNMTILQDHRQKEEKLRE
SEKLLEALQEEQKELKASLQSQE

CEP63

CEP63
PFAM accession number:PF17045
Interpro abstract (IPR031470): This entry represents the N-terminal domain of the centrosomal proteins Cep63 and Deup1. Cep63 regulates mother-centriole-dependent centriole duplication, whereas Deup1 governs deuterosome assembly for large-scale de novo centriole biogenesis [(PUBMED:24240477)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CEP63