The domain within your query sequence starts at position 609 and ends at position 815; the E-value for the CFTR_R domain shown below is 1.3e-97.

DFSSKLMGYDTFDQFTEERRSSILTETLRRFSVDDSSAPWSKPKQSFRQTGEVGEKRKNS
ILNSFSSVRKISIVQKTPLCIDGESDDLQEKRLSLVPDSEQGEAALPRSNMIATGPTFPG
RRRQSVLDLMTFTPNSGSSNLQRTRTSIRKISLVPQISLNEVDVYSRRLSQDSTLNITEE
INEEDLKECFLDDVIKIPPVTTWNTYL

CFTR_R

CFTR_R
PFAM accession number:PF14396
Interpro abstract (IPR025837):

Cystic fibrosis transmembrane conductance regulator (CFTR) that belongs to the ATP-binding cassette (ABC) transporter superfamily. It is a member of the ABC-C subfamily, which also contains the SUR receptors and the multidrug- resistance associated proteins (MRP) [(PUBMED:11435397)]. The CFTR protein encodes a chloride ion channel, which is controlled by phosphorylation. It has a major role in electrolyte and fluid secretion. CFTR is important in the determination of fluid flow, ion concentration and transepithelial salt transport. Dysfunction of the CFTR channel causes the life-threatening disease, cystic fibrosis, in which trans-epithelial ion transport is disrupted [(PUBMED:9922375)].

This entry represents the CFTR regulator domain [(PUBMED:16001079), (PUBMED:17660831), (PUBMED:21059651)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CFTR_R