The domain within your query sequence starts at position 20 and ends at position 172; the E-value for the CGI-121 domain shown below is 1.3e-47.

FKDVKNAGDLRKKAMEGSIDGSLINPNVIVDPFQILVAANKAVHLHRLGKMKTRTLSTEI
IFNLSPNNNISEALKKFGISETNTSVLIVYIEDGSKQVPQEHLVSQVEGQQVPLESLPEI
TRLSEVKKIYKLSSQEERIGTLLDAIICRMSTK

CGI-121

CGI-121
PFAM accession number:PF08617
Interpro abstract (IPR013926):

This entry represents the EKC/KEOPS complex subunit Cgi121 from fungi and its homologue, TPRKB from mammals. This entry also includes archaeal homologues [(PUBMED:18951093)].

CGI121 is part of the KEOPS complex, which is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t6A37) in tRNAs that read codons beginning with adenine [(PUBMED:21183954)]. The KEOPS complex also plays an important part in telomere uncapping and telomere elongation and is required for efficient recruitment of transcriptional coactivators [(PUBMED:16564010)].

TPRKB has been shown to bind to the p53-related protein kinase (PRPK) [(PUBMED:12659830)]. PRPK is a novel protein kinase which binds to and induces phosphorylation of the tumour suppressor protein p53.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CGI-121