The domain within your query sequence starts at position 11 and ends at position 99; the E-value for the CHB_HEX_C domain shown below is 1.1e-16.

IIPLRVPQPGKANHEIDTNTLLEMKSDTPDVNIYYTLDGSKPDFLKKVGSGENNTFKYVK
PITLPDGKIQVKAVAVSKDCRQSGIVTKV

CHB_HEX_C

CHB_HEX_C
PFAM accession number:PF03174
Interpro abstract (IPR004867):

E or "early" set domains are associated with the catalytic domain of chitobiase and beta-hexosaminidases (EC 3.2.1.52) at the C terminus. Chitobiase digests the beta, 1-4 glycosidic bonds of the N-acetylglucosamine (NAG) oligomers found in chitin, an important structural element of fungal cell wall and arthropod exoskeletons. It is thought to proceed through an acid-base reaction mechanism, in which one protein carboxylate acts as the catalytic acid, while the nucleophile is the polar acetamido group of the sugar in a substrate-assisted reaction with retention of the anomeric configuration [(PUBMED:10884356)]. The C terminus of chitobiase is composed of a beta sandwich structure [(PUBMED:8673609)] and may be related to the immunoglobulin and/or fibronectin type III superfamilies. E set domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CHB_HEX_C