The domain within your query sequence starts at position 1662 and ends at position 1833; the E-value for the CHDCT2 domain shown below is 4.4e-93.

LNEIWHRRHDYWLLAGIVLHGYARWQDIQNDAQFAIINEPFKTEANKGNFLEMKNKFLAR
RFKLLEQALVIEEQLRRAAYLNLSQEPAHPAMALHARFAEAECLAESHQHLSKESLAGNK
PANAVLHKVLNQLEELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRL

CHDCT2

CHDCT2
PFAM accession number:PF08074
Interpro abstract (IPR012957):

This entry represents the C-terminal domain of CHD (Chromodomain, Helicase, DNA-binding) proteins. CHD3 and CHD4 belong to the class II subfamily of CHD ATPases, and each is present as a core catalytic subunit in separate NuRD complexes, which regulate chromatin organisation and gene transcription [(PUBMED:23340908)]. CHD5 forms a NuRD-type chromatin remodeling complex and acts as a tumour suppressor [(PUBMED:24419087)].

There are nine members of the Chromodomain, Helicase, DNA-binding (CHD) family. They are characterised by two chromodomains arranged in tandem, N-terminal to the ATPase/helicase domain. Chromodomains are comprised of a beta-sheet folded against an alpha-helix that collectively mediates binding to methyl-lysine residues [(PUBMED:23954449)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CHDCT2