The domain within your query sequence starts at position 237 and ends at position 776; the E-value for the CHGN domain shown below is 9.8e-197.

HIGKCLREMYTTHEDVEVGRCVRRFAGVQCVWSYEMQQLFYENYEQNKKGYIRDLHSSKI
HRAITLHPNKNPPYQYRLHSYMLSRKIAELRHRTIQLHREIVLMSKYSSTEIQKEDLQLG
IPPSFMRFQARQREEILEWEFLTGKYLYSATDGQPPRRGMDSAQREALDDIVMQVMEMIN
ANAKTRGRIIDFKEIQYGYRRVNPMYGAEYILDLLLLYKKHKGKKMTVPVRRHAYLQQTF
SKMQFVEHEELDAQELADRINQDSGSLSFLSNSLKKLVAFQLPGSKTEHKEPKEKKINIL
IPLSGRFDMFVRFMGNFEKTCLIPNLNVKLVILLFNSDSNPDKAKQVELMRDYRVKYPKA
DMQVLPVSGGFSRALALEVGSSQFNNESLLFFCDVDLVFTAEFLQRCRANTVLGQQIYFP
IIFSQYDPKIVYSGKVPSDNHFAFTQKTGFWRNYGFGITCIYKGDLVRVGGFDVSIQGWG
LEDVDLFNKVVQAGLKTFRSQEVGVVHIHHPVVCDPNLDPKQYKMCLGSKASTFGSTQQL

CHGN

CHGN
PFAM accession number:PF05679
Interpro abstract (IPR008428):

This family represents Chondroitin N-acetylgalactosaminyltransferase. Proteins have a type II transmembrane topology. The enzyme is involved in the biosynthetic initiation and elongation of chondroitin sulphate and is the key enzyme responsible for the selective chain assembly of chondroitin/dermatan sulphate on the linkage region tetrasaccharide common to various proteoglycans containing chondroitin/dermatan sulphate or heparin/heparan sulphate chains [(PUBMED:11788602), (PUBMED:11514575)].

GO component:Golgi cisterna membrane (GO:0032580)
GO function:acetylgalactosaminyltransferase activity (GO:0008376)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CHGN