The domain within your query sequence starts at position 5 and ends at position 102; the E-value for the CI-B14_5a domain shown below is 2.1e-40.
TRVIQKLRNWASGQDLQAKLQLRYQEIAKRTQPPPKLPVGPSHKLSNNYYCTRDGRREVV PPSIIMSSQKALVSGKAAESSAMAATEKKAVTPAPPMK
CI-B14_5a |
 |
|---|
| PFAM accession number: | PF07347 |
|---|---|
| Interpro abstract (IPR009947): | This family contains the eukaryotic NADH:ubiquinone oxidoreductase subunit B14.5a (Complex I-B14.5a). This is approximately 100 residues long, and forms part of a multiprotein complex that resides on the inner mitochondrial membrane [ (PUBMED:9878551) ]. NADH:ubiquinone oxidoreductase (complex I) ( EC 1.6.5.3 ) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) [ (PUBMED:1470679) ]. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [ (PUBMED:10940377) ], mitochondria, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins [ (PUBMED:18394423) ]. |
| GO process: | ATP synthesis coupled electron transport (GO:0042773) |
| GO component: | mitochondrial inner membrane (GO:0005743) |
| GO function: | NADH dehydrogenase (ubiquinone) activity (GO:0008137) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CI-B14_5a