The domain within your query sequence starts at position 126 and ends at position 299; the E-value for the CIA30 domain shown below is 1.1e-47.

WQFREKEDLDKWIVTSDKTIGGRSEIFLKMSKNNRSALLYGTLSSEPPQDGDSRQSGYCA
MISRIPRGAFERKLSYDWSQFNTLYLRVRGDGRPWMVNIRQDTEFIQRKNQMYSYFMFTR
GGPYWQEVKIPFSKFFFSNQGRVRDVQGPLVLDKISSIGFTLSDKVDGPFFLEI

CIA30

CIA30
PFAM accession number:PF08547
Interpro abstract (IPR013857):

Mitochondrial complex I intermediate-associated protein 30 (CIA30) is present in human and mouse, and also in Schizosaccharomyces pombe (Fission yeast) which does not contain the NADH dehydrogenase component of complex I, or many of the other essential subunits. This means it is possible that it is not directly involved in oxidative phosphorylation [(PUBMED:11935339), (PUBMED:1518044)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CIA30