The domain within your query sequence starts at position 41 and ends at position 83; the E-value for the CIDE-N domain shown below is 2.1e-16.
RARPCRVSTADRKVRKGIMAHSLEDLLNKVQDILKLKDKPFSL
CIDE-N |
---|
PFAM accession number: | PF02017 |
---|---|
Interpro abstract (IPR003508): | The CIDE-N or CAD domain is a ~78 amino acid protein-protein interaction domain in the N-terminal part of Cell death-Inducing DFF45-like Effector (CIDE) proteins, involved in apoptosis. At the final stage of programmed cell death, chromosomal DNA is degraded into fragments by Caspase-activated DNase (CAD), also named DNA fragmentation factor 40kDa (DFF40). In normal cells CAD/DFF40 is completely inhibited by its binding to DFF45 or Inhibitor of CAD (ICAD). Apoptotic stimuli provoke cleavage of ICAD/DFF45 by caspases, resulting in self-assembly of CAD/DFF40 into the active dimer [ (PUBMED:15149602) ]. Both CAD/DFF40 and ICAD/DFF45 possess an N-terminal CIDE-N domain that is involved in their interaction. The name of the CIDE-N domain refers to the CIDE proteins and CAD, where the domain forms the N-terminal part [ (PUBMED:9564035) (PUBMED:10619428) ]. The CIDE-N domains from different proteins can interact, e.g. CIDE-N of CIDE-B and ICAD/DFF45 with CIDE-N of CAD/DFF40, and such interactions can also be needed for proper folding [ (PUBMED:10764577) (PUBMED:11371636) ]. Tertiary structures show that the CIDE-N domain forms an alpha/beta roll fold of five beta-strands forming a single, mixed parallel/anti-parallel beta-sheet with one [ (PUBMED:10764577) ] or two [ (PUBMED:10619428) (PUBMED:11371636) ] alpha-helices packed against the sheet. Binding surfaces of the CIDE-N domain form a central hydrophobic cluster, while specific binding interfaces can be formed by charged patches. Some proteins known to contain a CIDE-N domain include:
|
GO process: | apoptotic process (GO:0006915) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CIDE-N