The domain within your query sequence starts at position 1315 and ends at position 1455; the E-value for the CIMR domain shown below is 2.1e-58.

VYQRSTTIYFYCDRTTQKPVFLKETSDCSYMFEWRTQYACPPFNVTECSVQDAAGNSIDL
SSLSRYSDNWEAVTRTGATEHYLINVCKSLSPHAGTEPCPPEAAVCLLNGSKPVNLGKVR
DGPQWTDGVTVLQYVDGDLCP

CIMR

CIMR
PFAM accession number:PF00878
Interpro abstract (IPR000479):

The cation-independent mannose-6-phosphate receptor is a multi-functional transmembrane glycoprotein whose major function is to bind and transport M6P-bearing glycoproteins from the trans-Golgi network or the cell surface to lysosomes. It appears to mediate the uptake and processing of M6P-containing cytokines and peptide hormones, such as transforming growth factor-beta, leukemia inhibitory factor, and proliferin [(PUBMED:19251055)]. It also binds and internalizes the insulin-like growth factor II [(PUBMED:16779663)].

GO process:lysosomal transport (GO:0007041)
GO function:phosphoprotein binding (GO:0051219), signaling receptor activity (GO:0038023)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CIMR