The domain within your query sequence starts at position 315 and ends at position 651; the E-value for the CKAP2_C domain shown below is 3.9e-168.

ARTDSSNTRLMVKPKDTDQRRYTIAGASVHRSAQLKDTTAERKAQMTEWRTGKGKGLKRP
PHSVVTQAEPKGQSENPVGSFWTTMAEEDEQRLFTEKVNKTISECLNLINEGCPKEEILA
TLNDLIHNIPDAKKLVKYWICLVRIEPITSPIENIISIYEKAILAGAQPIEEMRHIIIDI
LTTKSQEKVNLGENIEEAHATKEPIQEVNADANVGSGKPGEENEHHGKVEVYEDDQDNKI
KDPDLTTPDSKTEAGCIIRYNVSSTPRLQSMKKMQHDKNSTLKELKFLTPVRRSRRIQDK
TSRLPAMLKDHDPSVSSLEQLSELGGDAFVCRPNAAL

CKAP2_C

CKAP2_C
PFAM accession number:PF15297
Interpro abstract (IPR029197):

This entry represents the C terminus of CKAP2 (cytoskeleton-associated protein 2) and CKAP2L (cytoskeleton-associated protein 2-like). Mouse CKAP2 has been shown to possess microtubule stabilising properties [(PUBMED:15504249)] and is involved in regulating aneuploidy, cell cycle, and cell death in a p53-dependent manner [(PUBMED:16061649)]. In human, CKAMP2 is up-regulated in primary gastric cancers [(PUBMED:12942315)]. It has been shown that human CKAP2 is degraded by APC/C-Cdh1 during mitotic exit and that a tight regulation of CKAP2 protein level is important for mitotic progression [(PUBMED:17376772)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CKAP2_C