The domain within your query sequence starts at position 493 and ends at position 706; the E-value for the CLASP_N domain shown below is 2.4e-21.

GLTDALQCLNSNDWQMKEKGLVNIQRLAACHSEVLGTRLHDVSLAVTAEVTNLRSKVSRL
AISTLGDLFRVLKKNMDQEAEEIVRCLLQKMGNTSEFIQRAANRALGAMVENVTPARALV
ALTSAGVYHRNPLVRKCTAKHLSAVLEQIGAEKLLSGSRDNTDMLVHNLVRLAQDSNQDT
RFYGRKMVNILMANAKFDAFLKQSLPSHDLRKVM

CLASP_N

CLASP_N
PFAM accession number:PF12348
Interpro abstract (IPR024395): This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [(PUBMED:16951255), (PUBMED:16914514)]. The domain is also found in other proteins involved in microtubule binding, including STU1, MOR1 and spindle pole body component Alp14.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CLASP_N