The domain within your query sequence starts at position 1 and ends at position 188; the E-value for the CLCA domain shown below is 6.5e-77.

PSRMIVYVRVSQGFLPVLGANVTAIIEAEHGHQVTLELWDNGAGADTVKNDGIYTRYFTD
YHGNGRYSLKVRVQARKNKARLSLRQKNKSLYIPGYVENGKIVLNPPRPDVQEEAIEATV
EDFNRVTSGGSFTVSGAPPDGDHARVFPPSKVTDLEAEFIGDYIQLTWTAPGKVLDKGRG
ESNGEFKM

CLCA

CLCA
PFAM accession number:PF08434
Interpro abstract (IPR013642):

The CLCA family of calcium-activated chloride channels has been identified in many epithelial and endothelial cell types as well as in smooth muscle cells [(PUBMED:11896056)] and has four or five putative transmembrane regions. Additionally to their role as chloride channels some CLCA proteins function as adhesion molecules and may also have roles as tumour suppressors [(PUBMED:15284223)]. This protein cleaves itself into an N-terminal portion and a C-terminal portion. The N terminus contains an HEXXHXXXGXXDE motif which is essential for proteolytic cleavage [(PUBMED:22350745), (PUBMED:23112050)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CLCA