The domain within your query sequence starts at position 51 and ends at position 80; the E-value for the CLLAC domain shown below is 2.5e-16.
RCSLWKVFLICLLACLVATSITALAFYFGP
CLLAC |
---|
PFAM accession number: | PF15675 |
---|---|
Interpro abstract (IPR031379): | This short domain is found in chordates. It carries a highly conserved CLLAC sequence motif. The function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CLLAC