The domain within your query sequence starts at position 34 and ends at position 332; the E-value for the CLN5 domain shown below is 9e-169.
QRWPVPYKRFSFRPKTDPYCQAKYTFCPTGSPIPVMKDNDVIEVLRLQAPIWEFKYGDLL GHFKLMHDAVGFRSTLTGKNYTIEWYELFQLGNCTFPHLRPDKSAPFWCNQGAACFFEGI DDKHWKENGTLSVVATISGNTFNKVAEWVKQDNETGIYYETWTVRAGPGQGAQTWFESYD CSNFVLRTYKKLAEFGTEFKKIETNYTKIFLYSGEPIYLGNETSIFGPKGNKTLALAIKK FYGPFRPYLSTKDFLMNFLKIFDTVIIHRQFYLFYNFEYWFLPMKPPFVKITYEETPLP
CLN5 |
---|
PFAM accession number: | PF15014 |
---|---|
Interpro abstract (IPR026138): | This protein family consist of CLN5 and CLN5-like proteins. Defects in CLN5 are the cause of neuronal ceroid lipofuscinosis type 5 (CLN5), also known as Finnish variant late-infantile neuronal ceroid lipofuscinosis (vLINCL). Neuronal ceroid lipofuscinoses are progressive neurodegenerative, lysosomal storage diseases characterised by intracellular accumulation of autofluorescent liposomal material [ (PUBMED:9662406) (PUBMED:15728307) (PUBMED:16814585) (PUBMED:17607606) (PUBMED:19309691) (PUBMED:21990111) (PUBMED:16935476) (PUBMED:16033706) ]. |
GO component: | lysosome (GO:0005764) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CLN5