The domain within your query sequence starts at position 34 and ends at position 332; the E-value for the CLN5 domain shown below is 9e-169.

QRWPVPYKRFSFRPKTDPYCQAKYTFCPTGSPIPVMKDNDVIEVLRLQAPIWEFKYGDLL
GHFKLMHDAVGFRSTLTGKNYTIEWYELFQLGNCTFPHLRPDKSAPFWCNQGAACFFEGI
DDKHWKENGTLSVVATISGNTFNKVAEWVKQDNETGIYYETWTVRAGPGQGAQTWFESYD
CSNFVLRTYKKLAEFGTEFKKIETNYTKIFLYSGEPIYLGNETSIFGPKGNKTLALAIKK
FYGPFRPYLSTKDFLMNFLKIFDTVIIHRQFYLFYNFEYWFLPMKPPFVKITYEETPLP

CLN5

CLN5
PFAM accession number:PF15014
Interpro abstract (IPR026138): This protein family consist of CLN5 and CLN5-like proteins. Defects in CLN5 are the cause of neuronal ceroid lipofuscinosis type 5 (CLN5), also known as Finnish variant late-infantile neuronal ceroid lipofuscinosis (vLINCL). Neuronal ceroid lipofuscinoses are progressive neurodegenerative, lysosomal storage diseases characterised by intracellular accumulation of autofluorescent liposomal material [(PUBMED:9662406), (PUBMED:15728307), (PUBMED:16814585), (PUBMED:17607606), (PUBMED:19309691), (PUBMED:21990111), (PUBMED:16935476), (PUBMED:16033706)].
GO component:lysosome (GO:0005764)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CLN5