The domain within your query sequence starts at position 15 and ends at position 107; the E-value for the CLP1_N domain shown below is 1.7e-36.
FELERETELRFEVEASQSVQLELLAGMAEIFGTELTRNKKFTFDAGAKVAVFTWHGCSLQ LSGRTEVAYVSKDTPMLLYLNTHTALEQMRRQA
CLP1_N |
 |
|---|
| PFAM accession number: | PF16573 |
|---|---|
| Interpro abstract (IPR032324): | This entry represents the short N-terminal domain of the pre-mRNA cleavage complex II protein Clp1. Clp1 function involves some degree of adenine or guanine nucleotide binding and participates in the 3' end processing of mRNAs in eukaryotes [ (PUBMED:17151076) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CLP1_N