The domain within your query sequence starts at position 1 and ends at position 91; the E-value for the CLTH domain shown below is 1.4e-11.
XIQVMMGSLVYLRLGLEKSPYCHLLDNSHWAEICETFTRDACSLLGLSVESPLSVSPIWD RVLGLCVIPAASVSALFLSFASGCVALPVLM
CLTH |
---|
PFAM accession number: | PF10607 |
---|---|
Interpro abstract (IPR024964): | RanBPM is a scaffolding protein and is important in regulating cellular function in both the immune system and the nervous system. The RanBPM protein contains multiple conserved domains that provide potential protein-protein interaction sites [ (PUBMED:22094242) ]. This entry represents a domain at the C terminus of RanBPM containing the CT11-RanBPM (CRA) motif. The CRA motif was found to be important for the interaction of RanBPM with fragile X mental retardation protein (FMRP), but its functional significance has yet to be determined [ (PUBMED:15381419) ]. The region comprising this domain contains the CTLH and CRA domains annotated by SMART; however, these may be a single domain, and is referred to as a C-terminal to LisH motif [ (PUBMED:11734546) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CLTH