The domain within your query sequence starts at position 394 and ends at position 614; the E-value for the CLU domain shown below is 3.4e-89.

DWNEELQTTRELPRKNLPERLLRERAIFKVHSDFTAAATRGAMAVIDGNVMAINPSEETK
MQMFIWNNIFFSLGFDVRDHYKDFGGDVAAYVAPTNDLNGVRTYNAVDVEGLYTLGTVVV
DYRGYRVTAQSIIPGILERDQEQSVIYGSIDFGKTVVSHPRYLELLERTSRPLKILRHRV
LNDRDEEVELCSSVECKGIIGNDGRHYILDLLRTFPPDLNF

CLU

CLU
PFAM accession number:PF13236
Interpro abstract (IPR025697):

The CLU domain (CLUstered mitochondria) is a eukaryotic domain found in highly conserved eukaryotic proteins required for correct mitochondrial dispersal [(PUBMED:9207087), (PUBMED:12952081)]. The exact function of the domain is unknown [(PUBMED:20457612)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CLU