The domain within your query sequence starts at position 104 and ends at position 177; the E-value for the CLU_N domain shown below is 3.1e-28.
PQEMVQEIHQVLMDREDTCHRTCFSLHLDGNMLDHFSELRSVEGLQEGSVLRVVEEPYTV REARIHVRHVRDLL
CLU_N |
 |
|---|
| PFAM accession number: | PF15044 |
|---|---|
| Interpro abstract (IPR028275): | This entry represents the N-terminal domain of the clustered mitochondria protein, also known as clueless protein in Drosophila. The function of this domain is not known. This domain is found in association with IPR025697 . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CLU_N