The domain within your query sequence starts at position 104 and ends at position 177; the E-value for the CLU_N domain shown below is 3.1e-28.

PQEMVQEIHQVLMDREDTCHRTCFSLHLDGNMLDHFSELRSVEGLQEGSVLRVVEEPYTV
REARIHVRHVRDLL

CLU_N

CLU_N
PFAM accession number:PF15044
Interpro abstract (IPR028275):

This entry represents the N-terminal domain of the clustered mitochondria protein, also known as clueless protein in Drosophila. The function of this domain is not known. This domain is found in association with IPR025697.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CLU_N