The domain within your query sequence starts at position 42 and ends at position 266; the E-value for the CMS1 domain shown below is 7.9e-35.

PEKTQQPTECFLTQTKEPKAEDSRKTRKWKKKKISDILAKSEPKPGTPEDLQKLIRDHYS
SSRSVIELEELHLPDSCFLKANDLTHSLSSYLKEICPKWVKLRKTHNEKKSVLMLILCSS
AVRALELIRSLTAFKGDAKVMKLFAKHIKVQEQVKLLEKRVIHLGVGTPGRIKELVKQDG
LHLNPLKFLVFDWNWRDQKLRRMMDIPEIRKEVFELLDMGVFSLC

CMS1

CMS1
PFAM accession number:PF14617
Interpro abstract (IPR032704):

This family includes fungal and plant Cms1 proteins and Cmss1 (Cms1 ribosomal small subunit homologue) from metazoa. Budding yeast Cms1 may play a role in the regulation of DNA replication and cell cycle control [(PUBMED:11787774)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CMS1