The domain within your query sequence starts at position 1087 and ends at position 1313; the E-value for the CNOT1_CAF1_bind domain shown below is 5.7e-99.

RIVEPPENIQEKIAFIFNNLSQSNMTQKVEELKETVKEEFMPWVSQYLVMKRVSIEPNFH
SLYSNFLDTLKNPEFNKMVLNETYRNIKVLLTSDKAAANFSDRSLLKNLGHWLGMITLAK
NKPILHTDLDVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSLVFRPPNPWTMAIMNVL
AELHQEHDLKLNLKFEIEVLCKNLALDINELKPGNLLKDKDRLKNLD

CNOT1_CAF1_bind

CNOT1_CAF1_bind
PFAM accession number:PF16415
Interpro abstract (IPR032191):

This is the CAF1-binding domain of CCR4-NOT transcription complex subunit 1, which is a scaffolding component of the CCR4-NOT complex. This domain adopts a MIF4G (middle portion of eIF4G) fold [(PUBMED:22977175)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CNOT1_CAF1_bind