The domain within your query sequence starts at position 1087 and ends at position 1313; the E-value for the CNOT1_CAF1_bind domain shown below is 5.7e-99.
RIVEPPENIQEKIAFIFNNLSQSNMTQKVEELKETVKEEFMPWVSQYLVMKRVSIEPNFH SLYSNFLDTLKNPEFNKMVLNETYRNIKVLLTSDKAAANFSDRSLLKNLGHWLGMITLAK NKPILHTDLDVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSLVFRPPNPWTMAIMNVL AELHQEHDLKLNLKFEIEVLCKNLALDINELKPGNLLKDKDRLKNLD
CNOT1_CAF1_bind |
---|
PFAM accession number: | PF16415 |
---|---|
Interpro abstract (IPR032191): | This is the CAF1-binding domain of CCR4-NOT transcription complex subunit 1, which is a scaffolding component of the CCR4-NOT complex. This domain adopts a MIF4G (middle portion of eIF4G) fold [ (PUBMED:22977175) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry CNOT1_CAF1_bind