The domain within your query sequence starts at position 500 and ends at position 656; the E-value for the CNOT1_HEAT domain shown below is 2.4e-57.

HELISTLMPIFLGNHPNSAIILHYAWHGQGQSPSIRQLIMHAMAEWYMRGEQYDQAKLSR
ILDVAQDLKALSMLLNGTPFAFVIDLAALASRREYLKLDKWLTDKIREHGEPFIQACMTF
LKRRCPSILGGLAPEKDQPKSAQLPAETLATMLACLQ

CNOT1_HEAT

CNOT1_HEAT
PFAM accession number:PF16418
Interpro abstract (IPR032194):

This domain is a HEAT repeat found in CCR4-NOT transcription complex subunit 1 [(PUBMED:22959269)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CNOT1_HEAT