The domain within your query sequence starts at position 812 and ends at position 1004; the E-value for the CNOT1_TTP_bind domain shown below is 1.4e-87.

SGLNQPTFQQSKMKPSDLSQVWPEANQHFSKEIDDEANSYFQRIYNHPPHPTMSVDEVLE
MLQRFKDSTIKREREVFNCMLRNLFEEYRFFPQYPDKELHITACLFGGIIEKGLVTYMAL
GLALRYVLEALRKPFGSKMYYFGIAALDRFKNRLKDYPQYCQHLASISHFMQFPHHLQEY
IEYGQQSRDPPVK

CNOT1_TTP_bind

CNOT1_TTP_bind
PFAM accession number:PF16417
Interpro abstract (IPR032193):

This entry represents the TTP binding domain of CCR4-NOT transcription complex subunit 1. It adopts a MIF4G (middle portion of eIF4G) fold [(PUBMED:23644599)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry CNOT1_TTP_bind