The domain within your query sequence starts at position 107 and ends at position 578; the E-value for the COBRA1 domain shown below is 3.5e-248.

TPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPVVMC
VMKHLPKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQALFGDEVSPLLKQYILEKESA
LFSTELSVLHNFFSPSPKTRRQGEVVQKLTQMVGKNVKLYDMVLQFLRTLFLRTRNVHYC
TLRAELLMSLHDLDVSDICTVDPCHKFTWCLDACIRERFVDSKRARELQGFLDGVKKGQE
QVLGDLSMILCDPFAINTLSLSTIRHLQELVSQETLPRDSPDLLLLLRLLALGQGAWDLI
DSQVFKEPKMEAELITKFLPMLMSLVVDDFTFNVDQKLPAEEKASVTYPNTLPESFTKFL
QEQRMACEVGLYYVLHITKQRNKNALLRLLPGLVETFGDLAFSDIFLHLLTGSLVLLADE
FALEDFCSSLFDGFFLTASPRKENVHRHVLRLLLHLHARVAPSKLEALQKAL

COBRA1

COBRA1
PFAM accession number:PF06209
Interpro abstract (IPR010405):

This family consists of several cofactor of BRCA1 (COBRA1) proteins (also known as negative elongation factor B). It is thought that COBRA1 along with BRCA1 is involved in chromatin unfolding. COBRA1 is recruited to the chromosome site by the first BRCT repeat of BRCA1, and is itself sufficient to induce chromatin unfolding. BRCA1 mutations that enhance chromatin unfolding also increase its affinity for, and recruitment of, COBRA1. It is thought that that reorganisation of higher levels of chromatin structure is an important regulated step in BRCA1-mediated nuclear functions [(PUBMED:11739404)].

GO process:negative regulation of transcription, DNA-templated (GO:0045892)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COBRA1