The domain within your query sequence starts at position 16 and ends at position 246; the E-value for the COE1_DBD domain shown below is 2.3e-145.

DKSLGAEMDSVRSWVRNVGVVDANVAAQSGVALSRAHFEKQPPSNLRKSNFFHFVLALYD
RQGQPVEIERTAFVDFVENDKEQGNEKTNNGTHYKLQLLYSNGVRTEQDLYVRLIDSVTK
QPIAYEGQNKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVIIDRFFLKFFLKCNQ
NCLKTAGNPRDMRRFQVVLSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRL

COE1_DBD

COE1_DBD
PFAM accession number:PF16422
Interpro abstract (IPR032200): This entry represents the DNA-binding domain of COE1, COE2, COE3 and COE4 (also known as Ebf1, Ebf2, Ebf3 and Ebf4), they belong to the early B cell factor family. COE1 is a key transcriptional determinant of B-lymphocyte differentiation [(PUBMED:20876732)]. COE3 is a transcription factor involved in neuronal differentiation and maturation [(PUBMED:28017373)].
GO function:DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COE1_DBD