The domain within your query sequence starts at position 15 and ends at position 101; the E-value for the COG2 domain shown below is 1.5e-37.

LCFDKDEFMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNL
STNLVGMDRALNQLSVPLGQLREEVLS

COG2

COG2
PFAM accession number:PF06148
Interpro abstract (IPR024602):

This entry represents the uncharacterised N-terminal domain of subunit 2 of the COG complex. The COG complex comprises eight proteins COG1-8 and plays critical roles in Golgi structure and function [ (PUBMED:11980916) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COG2