The domain within your query sequence starts at position 15 and ends at position 101; the E-value for the COG2 domain shown below is 1.5e-37.
LCFDKDEFMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNL STNLVGMDRALNQLSVPLGQLREEVLS
COG2 |
---|
PFAM accession number: | PF06148 |
---|---|
Interpro abstract (IPR024602): | This entry represents the uncharacterised N-terminal domain of subunit 2 of the COG complex. The COG complex comprises eight proteins COG1-8 and plays critical roles in Golgi structure and function [ (PUBMED:11980916) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry COG2