The domain within your query sequence starts at position 15 and ends at position 147; the E-value for the COG2 domain shown below is 1.4e-44.

LCFDKDEFMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNL
STNLVGMDRALNQLSVPLGQLREEVLSLRSSVSEGILAVDERMSKQEDIRKKKMSVLRLI
QVIRSVEKIEKIL

COG2

COG2
PFAM accession number:PF06148
Interpro abstract (IPR024602):

This entry represents the uncharacterised N-terminal domain of subunit 2 of the COG complex. The COG complex comprises eight proteins COG1-8 and plays critical roles in Golgi structure and function [(PUBMED:11980916)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COG2