The domain within your query sequence starts at position 1 and ends at position 156; the E-value for the COG4 domain shown below is 6.3e-43.

MRNSATEKIEPRELDPVLTEVTLMNARSELYLRFLRKRISADFEVGDSMASEEVKQEHQK
CLDKLLNNCLLSCTMQELIGFYITMEEYFMRETVNKAVALDTYEKGQLTSSMVDDVFYIV
KKCIGRALSSSNIDCLCAMINLATRELEADFRTSSV

COG4

COG4
PFAM accession number:PF08318
Interpro abstract (IPR013167):

This region is found in yeast oligomeric golgi complex component 4 which is involved in ER to Golgi and intra Golgi transport [(PUBMED:12006647)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COG4