The domain within your query sequence starts at position 39 and ends at position 174; the E-value for the COG6 domain shown below is 5.5e-32.

LHKILETRLENDKEHLEALLKHVTAQGVKENIQEVVGHITEGVCRPLKVRIEQVILAEPG
AVLLYKISNLLKFYHHTISGIVGNSAATLLTTIEEMHLLSKKIFFTSLSLHANKLMDKVE
LPPPDLGPSSALSQTL

COG6

COG6
PFAM accession number:PF06419
Interpro abstract (IPR010490):

COG6 is a component of the peripheral membrane COG complex that is involved in intra-Golgi protein trafficking. COG is located at the cis-Golgi, regulates tethering of retrograde intra-Golgi vesicles and possibly a number of other membrane trafficking events [(PUBMED:12011112), (PUBMED:12006647)].

GO process:intra-Golgi vesicle-mediated transport (GO:0006891)
GO component:Golgi transport complex (GO:0017119)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COG6