The domain within your query sequence starts at position 21 and ends at position 235; the E-value for the COPIIcoated_ERV domain shown below is 1e-95.

CYGAESEDIKCCNSCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGF
LEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIKHLSFGEDYPGIVNPLDH
TNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVL
YELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVR

COPIIcoated_ERV

COPIIcoated_ERV
PFAM accession number:PF07970
Interpro abstract (IPR012936):

This entry represents the C-terminal domain of the endoplasmic reticulum vesicle transporter proteins. Proteins included in this entry are conserved from plants and fungi to humans. Erv46 works in close conjunction with Erv41 and together they form a complex which cycles between the endoplasmic reticulum and Golgi complex. Erv46-41 interacts strongly with the endoplasmic reticulum glucosidase II. Mammalian glucosidase II comprises a catalytic alpha-subunit and a 58 kDa beta subunit, which is required for ER localisation. All proteins identified biochemically as Erv41p-Erv46p interactors are localised to the early secretory pathway and are involved in protein maturation and processing in the ER and/or sorting into COPII vesicles for transport to the Golgi [(PUBMED:17077122)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COPIIcoated_ERV