The domain within your query sequence starts at position 24 and ends at position 173; the E-value for the COPR5 domain shown below is 1.3e-87.
AGFATADLSGRETETELAVDRLASGAQSIPADIPAHAEGPSSEEEGFAVEKEADGELYAW ELSEGPSCPPMEQAADLFNEDWDLELKADQGNPYDADDIQGSISQEIKPWVCCAPQGDMI YDPSWHHPPPLIPHYSKMVFETGQFDDAED
COPR5 |
![]() |
---|
PFAM accession number: | PF15340 |
---|---|
Interpro abstract (IPR029289): | Coordinator of PRMT5 and differentiation stimulator (also known as COPRS or COPR5) is a histone-binding protein required for histone H4 methyltransferase activity of PRMT5, which targets nuclear and cytoplasmic proteins. COPR5 is specifically required for histone H4 'Arg-3' methylation mediated by PRMT5, but not histone H3 'Arg-8' methylation, suggesting that it modulates the substrate specificity of nuclear PRMT5-containing complexes, at least towards histones. Recombinant COPR5 binds to the N-terminal of histone H4 and is required to recruit PRMT5 to reconstituted nucleosomes in vitro [ (PUBMED:18404153) ]. |
GO process: | histone H4-R3 methylation (GO:0043985) |
GO component: | nucleus (GO:0005634) |
GO function: | histone binding (GO:0042393) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry COPR5