The domain within your query sequence starts at position 48 and ends at position 217; the E-value for the COQ7 domain shown below is 3.5e-78.
AVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKNHLKKFNELMIAFRVR PTVLMPLWNVAGFALGAGTALLGKEGAMACTVAVEESIANHYNNQIRMLMEEDPEKYEEL LQVIKQFRDEELEHHDTGLDHDAELAPAYALLKRIIQAGCSAAIYLSERF
COQ7 |
---|
PFAM accession number: | PF03232 |
---|---|
Interpro abstract (IPR011566): | Coq7 (also known as Clk-1 and CAT5) is a di-iron carboxylate protein occuring in both prokaryotes and eukaryotes that is essential for ubiquinone biosynthesis [ (PUBMED:8621692) (PUBMED:9823893) ]. It has been implicated in the aging process as mutations in the Caenorhabditis elegans gene lead to increased lifespan [ (PUBMED:9020081) ]. Coq7 is a membrane-bound protein that functions as a monooxygenase to hydroxylate demethoxyubiquinone (DMQ or 2-methoxy-5-methyl-6-polyprenyl-1,4-benzoquinone) in the penultimate step of ubiquinone biosynthesis [ (PUBMED:11435415) ]. Biochemical studies indicate that NADH can serve directly as a reductant for catalytic activation of dioxygen and substrate oxidation by the enzyme, with no requirement for an additional reductase protein component [ (PUBMED:20923139) ]. This direct reaction with NADH is so far unique amongst members of the di-iron carboxylate protein family. |
GO process: | ubiquinone biosynthetic process (GO:0006744) |
GO function: | monooxygenase activity (GO:0004497) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry COQ7