The domain within your query sequence starts at position 196 and ends at position 246; the E-value for the COQ9 domain shown below is 1.3e-20.

PRFNWYTRRAVLAGIYNTTELVMMQDSSPDFEDTWRFLENRINDAMNMGHT

COQ9

 COQ9
PFAM accession number:PF08511
Interpro abstract (IPR013718):

COQ9 is an enzyme that is required for the biosynthesis of coenzyme Q [ (PUBMED:16027161) ]. It may either catalyse a reaction in the coenzyme Q biosynthetic pathway or have a regulatory role.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COQ9