The domain within your query sequence starts at position 984 and ends at position 1176; the E-value for the COR domain shown below is 4.2e-10.

QLMSLQQFVYDVQDQLNPLASEDDLRRIAQQLHSTGEINIMQSETVQDVLLLDPRWLCTN
VLGKLLSVETPRALHHYRGRYTMEDIQRLVPDSDVEELLQILDAMDICARDLSSGTMVDI
PALIKTDSLQRSWADEEDEVMVYGGVRIVPVEHLTPFPCGIFHKVQVNLCRWIHQQSAEG
DADIRLWVSGCRI

COR

COR
PFAM accession number:PF16095
Interpro abstract (IPR032171):

The C-terminal of Roc domain, or COR domain, functions along with Roc as a putative regulator of kinase activity. It functions as a proper GTP-binding protein with a low GTPase activity somehow stimulating the kinase activity [(PUBMED:18650931)]. The Roc-COR tandem is found in bacterial and eukaryotic proteins. Its most prominent member is the leucine-rich repeat kinase LRRK2 [(PUBMED:18230735)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COR