The domain within your query sequence starts at position 73 and ends at position 402; the E-value for the COX15-CtaA domain shown below is 2.3e-112.

GRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWEAEFQKYQQFPE
FKILNHDMTLAEFKFIWYMEYSHRMWGRAVGLAYILPAAYFWRKGWLNRGMKGRVLALCG
LVCFQGLLGWYMVKSGLEEKPESYDIPRVSQYRLAAHLGSALVLYCASLWTSLSLLLPQH
KLPETRQLLWLRRFAGGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESWIPEDLLTFS
PVLKNVFENPTMVQFDHRLLGVTSVTAITVLYFLSRRIPLPRRTKMAAVTLLALAYAQVA
LGISTLLMYVPTPLAATHQSGSLALLSGAL

COX15-CtaA

• PFAM accession number: PF02628
• Interpro abstract (IPR003780):

  In some cases, heme A synthase is found fused to protoheme IX farnesyltransferase, an enzyme that converts protoheme IX to heme O.

  This is a family of integral membrane proteins. CtaA (also known as heme A synthase) is required for cytochrome aa3 oxidase assembly in Bacillus subtilis [ (PUBMED:2549006) ]. COX15 is required for cytochrome c oxidase assembly in yeast [ (PUBMED:9228094) ], and may also be involved in the synthesis of heme A [ (PUBMED:12474143) ].

• GO process: oxidation-reduction process (GO:0055114), heme A biosynthetic process (GO:0006784)
• GO component: integral component of membrane (GO:0016021)
• GO function: oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry COX15-CtaA