The domain within your query sequence starts at position 32 and ends at position 171; the E-value for the COX4 domain shown below is 4.2e-55.
QRRMTPYVDCYAQRSYPMPDEPFCTELSEEQRALKEKEKGSWTQLSQAEKVALYRLQFHE TFAEMNHRSNEWKTVMGCVFFFIGFTALVIWWQRVYVFPKKVVTLTEERKAQQLQRLLDM KSNPIQGLAAHWDYEKKEWK
COX4 |
---|
PFAM accession number: | PF02936 |
---|---|
Interpro abstract (IPR004203): | This family is composed of cytochrome c oxidase subunit 4 [ (PUBMED:11311561) ], and subunits 5A and 5B [ (PUBMED:2824989) ]. Proteins in this entry also include the yeast COX IV subunit, Mtc3 (maintenance of telomere cappining 3) protein [ (PUBMED:18845848) (PUBMED:14562095) ]. Cytochrome c oxidase (CcO)( EC 1.9.3.1 ), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Found only in eukaryotes, subunit IV is the largest of the nuclear-encoded subunits. It binds ATP at the matrix side, leading to an allosteric inhibition of enzyme activity at high intramitochondrial ATP/ADP ratios. In mammals, subunit IV has a lung-specific isoform and a ubiquitously expressed isoform [ (PUBMED:11311561) (PUBMED:16336199) (PUBMED:12973739) (PUBMED:12270909) (PUBMED:12909344) (PUBMED:11035249) (PUBMED:9752724) (PUBMED:8638158) (PUBMED:16760263) (PUBMED:16631971) (PUBMED:16199211) (PUBMED:15598510) ]. |
GO function: | cytochrome-c oxidase activity (GO:0004129) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry COX4