The domain within your query sequence starts at position 4 and ends at position 76; the E-value for the COX6C domain shown below is 1.5e-42.
GALLPKPQMRGLLAKRLRVHIAGAFIVALGVAAAYKFGVAEPRKKAYAEFYRNYDSMKDF EEMRKAGIFQSAK
COX6C |
---|
PFAM accession number: | PF02937 |
---|---|
Interpro abstract (IPR034884): | Cytochrome c oxidase (CcO; EC 1.9.3.1 ), a 13 subunit complex, is the terminal oxidase in the mitochondrial electron transport chain [ (PUBMED:16760263) (PUBMED:11035249) ]. This entry contains of cytochrome c oxidase subunit VIc, which is found only in eukaryotes and its specific function remains unclear. It has been reported that the relative concentrations of some nuclear encoded CcO subunits, including subunit VIc, compared to those of the mitochondrial encoded subunits, are altered significantly during the progression of prostate cancer [ (PUBMED:12973739) ]. This entry also includes Dictyostelium cytochrome c oxidase VIIs, an alternative subunit VII isoform produced under hypoxia [ (PUBMED:9049303) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry COX6C